Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Photosystem II D2 protein (psbD1)

This Recombinant Nostoc sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q8XFA5

Expression Region

1-351

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPSRGWFDVLDDWLKRDRFVFVGWSGILLFPCAFLALGGWLTGTTFVTSWYTH GLASSYLEGANFLTVAVSSPADSMGHSLLLLWGPEAQGDLTRWFQLGGLWPFVALHGAFG LIGFMLRQFEIARLVGIRPYNALAFSAPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFEDGEGANTFRAFNPTQSE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAVGIVGLALNLRAYDFVSQ ELRAAEDPEFETFYTKNILLNEGIRAWMAPQDQPHEKFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF488A conjugate, 0.1mg/mL
BNC881887-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS632091 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
Troponin C (TNNC2) (NM_003279) Human Over-expression Lysate
LY401130 100 µg

Troponin C (TNNC2) (NM_003279) Human Over-expression Lysate

Sign In for Pricing
View Details
1-O-Benzyl 6-O-Tosyl-D-mannose
TRC-B170685-250MG 250 mg

1-O-Benzyl 6-O-Tosyl-D-mannose

Sign In for Pricing
View Details
PPOX (NM_001122764) Human Over-expression Lysate
LC426558 20 µg

PPOX (NM_001122764) Human Over-expression Lysate

Sign In for Pricing
View Details
Acid Blue 113 (Technical Grade)
TRC-A189863-50MG 50 mg

Acid Blue 113 (Technical Grade)

Sign In for Pricing
View Details