Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Rod outer segment membrane protein 1 (Rom1)

This Recombinant Mouse Rod outer segment membrane protein 1 (Rom1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Rod outer segment membrane protein 1, ROSP1

UniProt

P32958

Expression Region

1-351

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPVLPVVLPLQPRIRLAQGIWLLSWLLALVGGLTLLCSGHLLVQLGHLGTFLAPSCSFP ALPQTALAAGTVALGTGLGGAGASRASLDAAQYPPWRGVLTPLLAVGTAAGGGLLTLALG LALALPVSLNQGLEEGLEAALAHYKDTEVPGRCQAKRLMDELQLRYHCCGRHGYKDWFGV QWVSNRYLDPSDQDVVDRIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPYAHPLFD PRQPNLNLWAQGCHEVLLEHLQGLSGTLGSILAVTLLLQILVLLGLRYLQTALEGLGGVI DGEGEAQGYLFPGGLKDILKTAWLQGGLAHKPAPEEAPPDEEPPKEVLAEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Chloro-4- (1,2-dibromoethyl) benzene
409506-01 100 mg

1-Chloro-4- (1,2-dibromoethyl) benzene

Sign In for Pricing
View Details
1-Chloro-4- (1,2-dibromoethyl) benzene
409506-02 250 mg

1-Chloro-4- (1,2-dibromoethyl) benzene

Sign In for Pricing
View Details
Anti-NSE/ENO2 Antibody Picoband®, Dylight550 Conjugate
A02930-Dylight550 100 µg

Anti-NSE/ENO2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
LPXN Antibody
orb620181 100 µL

LPXN Antibody

Sign In for Pricing
View Details
Mouse Eif2ak4 qPCR Primer Pair
QM06242S 200 Tests

Mouse Eif2ak4 qPCR Primer Pair

Sign In for Pricing
View Details
HIST1H1C Antibody (Center) Blocking Peptide
MBS9228053-01 0.5 mg

HIST1H1C Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details