Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Rod outer segment membrane protein 1 (Rom1)

This Recombinant Mouse Rod outer segment membrane protein 1 (Rom1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Rod outer segment membrane protein 1, ROSP1

UniProt

P32958

Expression Region

1-351

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPVLPVVLPLQPRIRLAQGIWLLSWLLALVGGLTLLCSGHLLVQLGHLGTFLAPSCSFP ALPQTALAAGTVALGTGLGGAGASRASLDAAQYPPWRGVLTPLLAVGTAAGGGLLTLALG LALALPVSLNQGLEEGLEAALAHYKDTEVPGRCQAKRLMDELQLRYHCCGRHGYKDWFGV QWVSNRYLDPSDQDVVDRIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPYAHPLFD PRQPNLNLWAQGCHEVLLEHLQGLSGTLGSILAVTLLLQILVLLGLRYLQTALEGLGGVI DGEGEAQGYLFPGGLKDILKTAWLQGGLAHKPAPEEAPPDEEPPKEVLAEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC85A (NM_001080433) Human Over-expression Lysate
LS114800 100 µg

CCDC85A (NM_001080433) Human Over-expression Lysate

Sign In for Pricing
View Details
CFHR1 (Complement Factor H-related Protein 1, FHR-1, H Factor-like Protein 1, H-Factor-like 1, H36, CFHL, CFHL1, CFHL1P, CFHR1P, FHR1, HFL1, HFL2, MGC104329)
124898 100 µg

CFHR1 (Complement Factor H-related Protein 1, FHR-1, H Factor-like Protein 1, H-Factor-like 1, H36, CFHL, CFHL1, CFHL1P, CFHR1P, FHR1, HFL1, HFL2, MGC104329)

Sign In for Pricing
View Details
Recombinant Mouse One cut domain family member 2 (Onecut2)
MBS1484592-01 0.02 mg (E-Coli)

Recombinant Mouse One cut domain family member 2 (Onecut2)

Sign In for Pricing
View Details
Recombinant Mouse One cut domain family member 2 (Onecut2)
MBS1484592-02 0.02 mg (Yeast)

Recombinant Mouse One cut domain family member 2 (Onecut2)

Sign In for Pricing
View Details
Recombinant Mouse One cut domain family member 2 (Onecut2)
MBS1484592-03 0.1 mg (E-Coli)

Recombinant Mouse One cut domain family member 2 (Onecut2)

Sign In for Pricing
View Details
Recombinant Mouse One cut domain family member 2 (Onecut2)
MBS1484592-04 0.1 mg (Yeast)

Recombinant Mouse One cut domain family member 2 (Onecut2)

Sign In for Pricing
View Details