Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Gap junction alpha-4 protein (gja4)

This Recombinant Xenopus laevis Gap junction alpha-4 protein (gja4) spans the amino acid sequence from region 2-352.

Product Specifications

Product Name Alternative

Gap junction alpha-4 protein, Connexin-41, Cx41

UniProt

P51914

Expression Region

2-352

Origin

Xenopus laevis (African clawed frog)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWEFLEKLLDQVQEHSTSIGKIWLMVLFIFRILILGLAGESVWGDEQSDFTCNTEQPGC TNVCYDKAFPISHVRYWVLQFLFVSTPTLFYLGHVIYLSRKEEKLKQKESELRALDDKEQ VEQAIAIIEKKKLKLYIQEDGTVKIKGALMYTYLTSVIFKSIFEAGFLLGQWYLYGFVMT PIYVCERVPCPHKVDCFVSRPMEKTIFIIFMLVVSLISLFLNVLELIHLICKSMIHALKK YSQYIPANRYPKNEDTYPEKTSETATAPFQDKSYIYLPMNENISYPQYKMPNEQNWVNFN TEQQLAISGNTQSPLGHYSLSAFLPVSPKTHSTVEKASTRASSSASKKQYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-500 1x 500 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details