Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P48079

Expression Region

1-352

Origin

Cyanophora paradoxa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVAIGRSDSERGWFDVLDDWLKRDRFVFLGWSGLLLLPCAYLAVGAWFTGTTFVTSWYT HGLASSYLEGCNFLTAAVSTPANSMGHSILFVWGPEAQGDFTRWCQIGGLWTFTALHGAL GLIGFTLRQFEIARLIGLRPYNAIAFSGPIAVFVSVFLLYPLGQAGWFFAPSFGVAAIFR FLLFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGSNTFPAFNPTQA EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLGVNLRAYDFVS QEIRAAEDPEFETFYTKNLLLNEGIRAWMAVQDQPHENFVFSEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLK1 activation kit by CRISPRa
GA100854 1 Kit

Human CLK1 activation kit by CRISPRa

Sign In for Pricing
View Details
CEACAM18 Human Gene Knockout Kit (CRISPR)
KN415478 1 Kit

CEACAM18 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF488A conjugate, 0.1mg/mL
BNC880859-100 1x 100 µL

Human Kappa Light Chain (Kap-56), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCEAL1 Mouse Monoclonal Antibody [Clone ID: OTI2A1]
CF807708 100 µg

TCEAL1 Mouse Monoclonal Antibody [Clone ID: OTI2A1]

Sign In for Pricing
View Details
Recombinant beta II Tubulin Antibody
RC-15397-01 50 μL

Recombinant beta II Tubulin Antibody

Sign In for Pricing
View Details
Recombinant beta II Tubulin Antibody
RC-15397-02 100 µL

Recombinant beta II Tubulin Antibody

Sign In for Pricing
View Details