Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorella vulgaris Photosystem II D2 protein (psbD)

This Recombinant Chlorella vulgaris Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P56319

Expression Region

1-352

Origin

Chlorella vulgaris (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGKTQEKRGLFDVVDDWLRRDRFVFVGWSGLLLFPTAYLALGGWFTGTTFVTSWYT HGLATSYLEGCNFLTAAVSTPANSMGHSLLFLWGPEAQGDFTRWCQLGGLWTFVALHGSF ALIGFMLRQFEIARSVKIRPYNAIAFSAPISVFVSVFLIYPLGQSGWFFAPSFGVAAIFR FILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQA EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVS QEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHEKLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTBD10 (NM_032320) Human Tagged Lenti ORF Clone
RC202973L2 10 µg

BTBD10 (NM_032320) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HERG1, CT (Erg1, Kcnh2, Ether-a-go-go-related Channel 1, Voltage-gated Potassium Channel)
MBS612402-01 0.1 mg

HERG1, CT (Erg1, Kcnh2, Ether-a-go-go-related Channel 1, Voltage-gated Potassium Channel)

Sign In for Pricing
View Details
HERG1, CT (Erg1, Kcnh2, Ether-a-go-go-related Channel 1, Voltage-gated Potassium Channel)
MBS612402-02 5x 0.1 mg

HERG1, CT (Erg1, Kcnh2, Ether-a-go-go-related Channel 1, Voltage-gated Potassium Channel)

Sign In for Pricing
View Details
NECAP1 Adenovirus (Rat)
31679056 1.0 mL

NECAP1 Adenovirus (Rat)

Sign In for Pricing
View Details
HTR1B Rabbit pAb
E45R30046N-50 50 µL

HTR1B Rabbit pAb

Sign In for Pricing
View Details
Chicken Heat Shock Protein 70,HSP-70 ELISA KIT
JOT-EKA0022Ch 96 wells

Chicken Heat Shock Protein 70,HSP-70 ELISA KIT

Sign In for Pricing
View Details