Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorella vulgaris Photosystem II D2 protein (psbD)

This Recombinant Chlorella vulgaris Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P56319

Expression Region

1-352

Origin

Chlorella vulgaris (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGKTQEKRGLFDVVDDWLRRDRFVFVGWSGLLLFPTAYLALGGWFTGTTFVTSWYT HGLATSYLEGCNFLTAAVSTPANSMGHSLLFLWGPEAQGDFTRWCQLGGLWTFVALHGSF ALIGFMLRQFEIARSVKIRPYNAIAFSAPISVFVSVFLIYPLGQSGWFFAPSFGVAAIFR FILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQA EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVS QEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHEKLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SELENON Antibody Blocking Peptide
orb1507095 500 µg

SELENON Antibody Blocking Peptide

Sign In for Pricing
View Details
Papilloma Virus, Human, Type 18, Early Protein 7 (hPV) (FITC)
P3105-25-FITC 100 µL

Papilloma Virus, Human, Type 18, Early Protein 7 (hPV) (FITC)

Sign In for Pricing
View Details
PP1 10mg
A12724-10 10 mg

PP1 10mg

Sign In for Pricing
View Details
Ear3 Protein Vector (Mouse) (pPM-C-His)
PV174217 500 ng

Ear3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
RIMS1 Protein Vector (Mouse) (pPB-C-His)
PV224302 500 ng

RIMS1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
AMBRA1 Knockout NCI-H1299 Polyclonal Cells
ARG30315 1 Million

AMBRA1 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details