Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Photosystem II D2 protein (psbD)

This Recombinant Synechocystis sp. Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P09192

Expression Region

1-352

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPVERGWFDVLDDWLKRDRFVFIGWSGLLLFPCAFMALGGWLTGTTFVTSWYT HGLASSYLEGANFLTVAVSSPADAFGHSLLFLWGPEAQGNLTRWFQIGGLWPFVALHGAF GLIGFMLRQFEISRLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAGIFR FILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEDSNTFRAFEPTQA EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVS QELRAAEDPEFETFYTKNILLNEGMRAWMAPQDQPHENFIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endoglin/CD105 Monoclonal Antibody
AN200002P 100 µL

Endoglin/CD105 Monoclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Chicken Affinity Purified Antibody to Protein G,  40nm
GM-501-40 1 mL

Colloidal Gold Conjugated Chicken Affinity Purified Antibody to Protein G, 40nm

Sign In for Pricing
View Details
PE Anti-Mouse CD90 Antibody
RD30525F-01 25 µg

PE Anti-Mouse CD90 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD90 Antibody
RD30525F-02 100 µg

PE Anti-Mouse CD90 Antibody

Sign In for Pricing
View Details
Epigen (EPGN) (N-term) Rabbit Polyclonal Antibody
AP51442PU-N 400 µL

Epigen (EPGN) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF647 conjugate, 0.1mg/mL
BNC471718-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details