Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Photosystem II D2 protein (psbD)

This Recombinant Synechocystis sp. Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P09192

Expression Region

1-352

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPVERGWFDVLDDWLKRDRFVFIGWSGLLLFPCAFMALGGWLTGTTFVTSWYT HGLASSYLEGANFLTVAVSSPADAFGHSLLFLWGPEAQGNLTRWFQIGGLWPFVALHGAF GLIGFMLRQFEISRLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAGIFR FILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEDSNTFRAFEPTQA EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVS QELRAAEDPEFETFYTKNILLNEGMRAWMAPQDQPHENFIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V-Elab Fluor® 488/PI Apoptosis Kit
E-CK-A237-01 20 Assays

Annexin V-Elab Fluor® 488/PI Apoptosis Kit

Sign In for Pricing
View Details
Annexin V-Elab Fluor® 488/PI Apoptosis Kit
E-CK-A237-02 100 Assays

Annexin V-Elab Fluor® 488/PI Apoptosis Kit

Sign In for Pricing
View Details
ORM2 Polyclonal Antibody
E-AB-14761-01 20 µL

ORM2 Polyclonal Antibody

Sign In for Pricing
View Details
ORM2 Polyclonal Antibody
E-AB-14761-02 60 µL

ORM2 Polyclonal Antibody

Sign In for Pricing
View Details
ORM2 Polyclonal Antibody
E-AB-14761-03 120 µL

ORM2 Polyclonal Antibody

Sign In for Pricing
View Details
ORM2 Polyclonal Antibody
E-AB-14761-04 200 µL

ORM2 Polyclonal Antibody

Sign In for Pricing
View Details