Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Photosystem II D2 protein (psbD)

This Recombinant Spinacia oleracea Photosystem II D2 protein (psbD) spans the amino acid sequence from region 2-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P06005

Expression Region

2-353

Origin

Spinacia oleracea (Spinach)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TIAVGKFTKDEKDLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYT HGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGAF ALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFR FILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQA EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVS QEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondrial Marker (113-1), CF568 conjugate, 0.1mg/mL
BNC680739-500 1x 500 µL

Mitochondrial Marker (113-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODAD4 (NM_031421) Human Recombinant Protein
TP309614 20 µg

ODAD4 (NM_031421) Human Recombinant Protein

Sign In for Pricing
View Details
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), RPE-AstralTM616 Conjugate - Biotium Choice
P015-R616-500 1x 500 µL

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), RPE-AstralTM616 Conjugate - Biotium Choice

Sign In for Pricing
View Details
GABPB2 (GABPB1) Mouse Monoclonal Antibody [Clone ID: OTI4H6]
CF811263 100 µg

GABPB2 (GABPB1) Mouse Monoclonal Antibody [Clone ID: OTI4H6]

Sign In for Pricing
View Details
Recombinant Mouse MMP-9 protein (His tag)
PDEM100276-01 20 µg

Recombinant Mouse MMP-9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse MMP-9 protein (His tag)
PDEM100276-02 100 µg

Recombinant Mouse MMP-9 protein (His tag)

Sign In for Pricing
View Details