Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cell division protein FtsX (ftsX)

This Recombinant Cell division protein FtsX (ftsX) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Cell division protein FtsX

UniProt

P0AC31

Expression Region

1-352

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-17D Protein (Gst Tag)
PDEH100605-01 20 µg

Recombinant Human IL-17D Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human IL-17D Protein (Gst Tag)
PDEH100605-02 100 µg

Recombinant Human IL-17D Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human IL-17D Protein (Gst Tag)
PDEH100605-03 500 µg

Recombinant Human IL-17D Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human IL-17D Protein (Gst Tag)
PDEH100605-04 1 mg

Recombinant Human IL-17D Protein (Gst Tag)

Sign In for Pricing
View Details
Ran Recombinant Rabbit Monoclonal Antibody [JE33-28]
HA721406 100 µL

Ran Recombinant Rabbit Monoclonal Antibody [JE33-28]

Sign In for Pricing
View Details
CD1 (CD1A) Mouse Monoclonal Antibody [Clone ID: 7A7]
AM06599SU-N 100 µL

CD1 (CD1A) Mouse Monoclonal Antibody [Clone ID: 7A7]

Sign In for Pricing
View Details