Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cell division protein FtsX (ftsX)

This Recombinant Cell division protein FtsX (ftsX) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Cell division protein FtsX

UniProt

P0AC31

Expression Region

1-352

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MMP-3, Tag Free
HA211280-01 20 µg

Mouse MMP-3, Tag Free

Sign In for Pricing
View Details
Mouse MMP-3, Tag Free
HA211280-02 50 µg

Mouse MMP-3, Tag Free

Sign In for Pricing
View Details
Mouse MMP-3, Tag Free
HA211280-03 100 µg

Mouse MMP-3, Tag Free

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS624798 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
3-Vinylpyridine (>90%)
TRC-V487500-1G 1 g

3-Vinylpyridine (>90%)

Sign In for Pricing
View Details
Human ZNF480 activation kit by CRISPRa
GA115614 1 Kit

Human ZNF480 activation kit by CRISPRa

Sign In for Pricing
View Details