Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD1)

This Recombinant Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

B1X3H4

Expression Region

1-352

Origin

Paulinella chromatophora

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPAARGWFDILDDWLKRDRFVFVGWSGLLLFPTAYLALGGWLTGTTFVTSWYT HGIASSYLEGCNFLTAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLGGLWAFVALHGAF ALIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFR FLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEQANTFKAFEPTQE EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFVS QEIRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL12A (C-term) Rabbit Polyclonal Antibody
AP18069PU-N 400 µL

IL12A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Potassium Hydroxide (Semiconductor Grade)
TRC-P695600-25G 25 g

Potassium Hydroxide (Semiconductor Grade)

Sign In for Pricing
View Details
Intrinsic Factor (GIF) (Center) Rabbit Polyclonal Antibody
AP51837PU-N 400 µL

Intrinsic Factor (GIF) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Col6a4 Mouse Gene Knockout Kit (CRISPR)
KN503648 1 Kit

Col6a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HOXD10 (C-term) Rabbit Polyclonal Antibody
AP52084PU-N 400 µL

HOXD10 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDRG2 (NM_201535) Human Recombinant Protein
TP319812L 1 mg

NDRG2 (NM_201535) Human Recombinant Protein

Sign In for Pricing
View Details