Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q2JKT8

Expression Region

1-352

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRVRQERGWFDIVDDWLKRDRFVFIGWSGLLLFPCAYLALGGWLTGTTFVTSWYT HGLASSYLEGCNFLTVAVSTPADSMGHSLLLLWGPEAQGDFTRWCQIGGLWTFVALHGAL GLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAGIFR FLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEAASTFRAFEPTQS EETYSMVTANRYWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSIGVVGLALNLRAYDFIS QEVRAAEDPEFETFYTKNILLNEGIRAWMAPQDQPHERFEFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF488A conjugate, 0.1mg/mL
BNC881070-100 1x 100 µL

TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHF7 (NM_016483) Human Over-expression Lysate
LY402558 100 µg

PHF7 (NM_016483) Human Over-expression Lysate

Sign In for Pricing
View Details
Phenylsuccinic Acid
TRC-P336863-500MG 500 mg

Phenylsuccinic Acid

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1014), CF640R conjugate, 0.1mg/mL
BNC400224-500 1x 500 µL

Major Vault Protein (MVP) (1014), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 555 succinimidyl ester
71507-AAT 5 mg

IFluor® 555 succinimidyl ester

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF594 conjugate, 0.1mg/mL
BNC940500-100 1x 100 µL

Progesterone Receptor (PR500), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details