Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q2JKT8

Expression Region

1-352

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRVRQERGWFDIVDDWLKRDRFVFIGWSGLLLFPCAYLALGGWLTGTTFVTSWYT HGLASSYLEGCNFLTVAVSTPADSMGHSLLLLWGPEAQGDFTRWCQIGGLWTFVALHGAL GLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAGIFR FLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEAASTFRAFEPTQS EETYSMVTANRYWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSIGVVGLALNLRAYDFIS QEVRAAEDPEFETFYTKNILLNEGIRAWMAPQDQPHERFEFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Small intestine
CS708221 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
TRIM49D2 (NM_001105522) Human Over-expression Lysate
LY426249 100 µg

TRIM49D2 (NM_001105522) Human Over-expression Lysate

Sign In for Pricing
View Details
MST1 (STK4) (NM_006282) Human Over-expression Lysate
LC401893 20 µg

MST1 (STK4) (NM_006282) Human Over-expression Lysate

Sign In for Pricing
View Details
JUNB Rabbit Monoclonal Antibody
TA422779 100 µL

JUNB Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DAZAP1 (NM_018959) Human Recombinant Protein
TP304091 20 µg

DAZAP1 (NM_018959) Human Recombinant Protein

Sign In for Pricing
View Details
1-(4-Formylphenyl)-4-piperidinecarboxylic Acid
TRC-B594025-50MG 50 mg

1-(4-Formylphenyl)-4-piperidinecarboxylic Acid

Sign In for Pricing
View Details