Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein 2 (psbD2)

This Recombinant Synechococcus sp. Photosystem II D2 protein 2 (psbD2) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein 2, PSII D2 protein 2, EC= 1.10.3.9, Photosystem Q (A) protein 2

UniProt

Q5MZ82

Expression Region

1-352

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPAERGWFDVLDDWLKRDRYVFVGWSGLLLFPCAYLALGGWLTGTSFVTSWYT HGIASSYLEGGNFLTVAVSTPADAFGHSLMLLWGPEAQGNFVRWCQLGGLWNFVALHGAF GLIGFMLRQFEIARLVGVRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFR FLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSEQSNTFRAFEPTQA EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSIGIVGLALNLRAYDFVS QELRAAEDPEFETFYTKNILLNEGIRAWMAPQDQPHEKFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCRL1 Protein Vector (Human) (pPM-C-HA)
15435021 500 ng

CCRL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
LMNA Antibody
MBS2519160-01 0.06 mL

LMNA Antibody

Sign In for Pricing
View Details
LMNA Antibody
MBS2519160-02 0.12 mL

LMNA Antibody

Sign In for Pricing
View Details
LMNA Antibody
MBS2519160-03 0.2 mL

LMNA Antibody

Sign In for Pricing
View Details
LMNA Antibody
MBS2519160-04 5x 0.2 mL

LMNA Antibody

Sign In for Pricing
View Details
Anti-CD3 Antibody-PerCP/Cy5.5 labled
MBS8321903-01 25 Assays

Anti-CD3 Antibody-PerCP/Cy5.5 labled

Sign In for Pricing
View Details