Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein 2 (psbD2)

This Recombinant Synechococcus sp. Photosystem II D2 protein 2 (psbD2) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein 2, PSII D2 protein 2, EC= 1.10.3.9, Photosystem Q (A) protein 2

UniProt

Q5MZ82

Expression Region

1-352

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPAERGWFDVLDDWLKRDRYVFVGWSGLLLFPCAYLALGGWLTGTSFVTSWYT HGIASSYLEGGNFLTVAVSTPADAFGHSLMLLWGPEAQGNFVRWCQLGGLWNFVALHGAF GLIGFMLRQFEIARLVGVRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFR FLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSEQSNTFRAFEPTQA EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSIGIVGLALNLRAYDFVS QELRAAEDPEFETFYTKNILLNEGIRAWMAPQDQPHEKFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TREM1 HEK-293 Cell Line
ABC-X0566F 1 Vial

TREM1 HEK-293 Cell Line

Sign In for Pricing
View Details
RBBP7, ID (RBBP7, RBAP46, Histone-binding protein RBBP7, Histone acetyltransferase type B subunit 2, Nucleosome-remodeling factor subunit RBAP46, Retinoblastoma-binding protein 7, Retinoblastoma-binding protein p46) (MaxLight 490) discontinued
040874-ML490 100 µL

RBBP7, ID (RBBP7, RBAP46, Histone-binding protein RBBP7, Histone acetyltransferase type B subunit 2, Nucleosome-remodeling factor subunit RBAP46, Retinoblastoma-binding protein 7, Retinoblastoma-binding protein p46) (MaxLight 490) discontinued

Sign In for Pricing
View Details
AKR1CL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV701199 1.0 µg DNA

AKR1CL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PTPN12 sgRNA CRISPR Lentivector (Human) (Target 1)
K1756202 1.0 µg DNA

PTPN12 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Bovine Mitochondrial cardiolipin hydrolase (PLD6)
MBS1044656 Inquire

Recombinant Bovine Mitochondrial cardiolipin hydrolase (PLD6)

Sign In for Pricing
View Details
Beta galactosidase Polyclonal Antibody
bs-4960R-TR 20 µL

Beta galactosidase Polyclonal Antibody

Sign In for Pricing
View Details