Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nephroselmis olivacea Photosystem II D2 protein (psbD)

This Recombinant Nephroselmis olivacea Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q9TL00

Expression Region

1-352

Origin

Nephroselmis olivacea (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGTPEEKRGLFDDMDDWLRRDRFVFVGWSGLLLLPCAYFAVGGWLTGTTFVTSWYT HGLASSYLEGCNVLTAAVSTPANSMAHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGSF GLIGFMLRQFEIARAIGLRPYNAIAFSGPISVFVSVFLIYPLGQSGWFFAPSFGVAAIFR FILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQA EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVS QELRAAEDPEFETFYTKNLLLNEGIRAWMAAQDQPHEKLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC7 Antibody
58-414 400 µL

SIGLEC7 Antibody

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)
MBS2062251-01 0.1 mL

HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)
MBS2062251-02 0.2 mL

HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)
MBS2062251-03 0.5 mL

HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)
MBS2062251-04 1 mL

HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)
MBS2062251-05 5 mL

HRP-Linked Polyclonal Antibody to Creatine Kinase, Brain (CKB)

Sign In for Pricing
View Details