Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Secretion system apparatus protein ssaU (ssaU)

This Recombinant Salmonella typhimurium Secretion system apparatus protein ssaU (ssaU) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Secretion system apparatus protein ssaU

UniProt

P96069

Expression Region

1-352

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEKTEQPTEKKLRDGRKEGQVVKSIEITSLFQLIALYLYFHFFTEKMILILIESITFTL QLVNKPFSYALTQLSHALIESLTSALLFLGAGVIVATVGSVFLQVGVVIASKAIGFKSEH INPVSNFKQIFSLHSVVELCKSSLKVIMLSLIFAFFFYYYASTFRALPYCGLACGVLVVS SLIKWLWVGVMVFYIVVGILDYSFQYYKIRKDLKMSKDDVKQEHKDLEGDPQMKTRRREM QSEIQSGSLAQSVKQSVAVVRNPTHIAVCLGYHPTDMPIPRVLEKGSDAQANYIVNIAER NCIPVVENVELARSLFFEVERGDKIPETLFEPVAALLRMVMKIDYAHSTETP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-100 1x 100 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-100 1x 100 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details