Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P20898

Expression Region

1-352

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPQERGWFDVLDDWLKRDRFVFVGWSGILLFPCAFMALGGWLTGTTFVTSWYT HGLASSYLEGCNFLTVAVSSPADSLGHSLLFLWGPEANWNFARWCQLGGLWSFVALHGAF GLIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAGIFR FILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSDQANTFRAFEPTQA EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVS QEIRAAEDPEFETFYTKNILLNEGMRAWMAPQDQIHEQFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMM CRISPR Knock Out 293T Cell Line (Human)
16422141 1x 10^6 Cells / 1.0 mL

CMM CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
MMAB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1310007 1.0 µg DNA

MMAB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PDXDC1 Protein Lysate (Mouse) with C-HA Tag
36344034 100 µg

PDXDC1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Pan-Keratin (C11) Mouse Monoclonal Antibody (BSA and Azide Free)
CST 17171SF 100 µg

Pan-Keratin (C11) Mouse Monoclonal Antibody (BSA and Azide Free)

Sign In for Pricing
View Details
Rat SQSTM1 (Sequestosome-1) ELISA Kit
orb2816843-01 48 Tests

Rat SQSTM1 (Sequestosome-1) ELISA Kit

Sign In for Pricing
View Details
Rat SQSTM1 (Sequestosome-1) ELISA Kit
orb2816843-02 96 Tests

Rat SQSTM1 (Sequestosome-1) ELISA Kit

Sign In for Pricing
View Details