Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P20898

Expression Region

1-352

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPQERGWFDVLDDWLKRDRFVFVGWSGILLFPCAFMALGGWLTGTTFVTSWYT HGLASSYLEGCNFLTVAVSSPADSLGHSLLFLWGPEANWNFARWCQLGGLWSFVALHGAF GLIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAGIFR FILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSDQANTFRAFEPTQA EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVS QEIRAAEDPEFETFYTKNILLNEGMRAWMAPQDQIHEQFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNGR1 (NM_000416) Human Tagged Lenti ORF Clone
RC202761L3 10 µg

IFNGR1 (NM_000416) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
EZH1 Antibody, HRP conjugated
CSB-PA852913DB01HU-01 50 µg

EZH1 Antibody, HRP conjugated

Sign In for Pricing
View Details
EZH1 Antibody, HRP conjugated
CSB-PA852913DB01HU-02 100 µg

EZH1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Polr3d ORF Vector (Rat) (pORF)
ORF073795 1.0 µg DNA

Polr3d ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
TUBA1C Rabbit Polyclonal Antibody (HRP)
orb2097131 100 µL

TUBA1C Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ADRA1A Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2557339 100 µL

ADRA1A Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details