Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P31557

Expression Region

1-352

Origin

Euglena gracilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFTDLNTENKNGWFDVADDWLKKDRFIFIGWSGLLLFPCSYLALGGWLTGITFVTSWYT HGLASSFLEGCNALTAAVSTPPNSMGHSLLLLLGSEAQWDFTRWLQIGGLWPFIALHGAF GLIGFMLRQFEIAKAVQIRPYNAIAFSAPISVFVSVFLIYPLGQSGWFFAPSFGVAAIFR FILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTIFEDGDSPNTFRAFNPLQS EETYSMVTANRFWSQIFGVAFSNKRWLHFFMVFVPVTGLRMSALGIVGLALNLRAYDFVS QEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHEQFIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cep55-set siRNA/shRNA/RNAi Lentivector (Mouse)
15908094 4x 500 ng

Cep55-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB619792 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
ASPN, ID (Asporin, Periodontal Ligament-associated Protein 1, PLAP-1, SLRR1C, PLAP1, UNQ215/PRO241) (FITC)
MBS6464311-01 0.2 mL

ASPN, ID (Asporin, Periodontal Ligament-associated Protein 1, PLAP-1, SLRR1C, PLAP1, UNQ215/PRO241) (FITC)

Sign In for Pricing
View Details
ASPN, ID (Asporin, Periodontal Ligament-associated Protein 1, PLAP-1, SLRR1C, PLAP1, UNQ215/PRO241) (FITC)
MBS6464311-02 5x 0.2 mL

ASPN, ID (Asporin, Periodontal Ligament-associated Protein 1, PLAP-1, SLRR1C, PLAP1, UNQ215/PRO241) (FITC)

Sign In for Pricing
View Details
Mmu-miR-7070-3p miRNA Antagomir
orb1912109-01 10 nmol

Mmu-miR-7070-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-7070-3p miRNA Antagomir
orb1912109-02 20 nmol

Mmu-miR-7070-3p miRNA Antagomir

Sign In for Pricing
View Details