Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P31557

Expression Region

1-352

Origin

Euglena gracilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFTDLNTENKNGWFDVADDWLKKDRFIFIGWSGLLLFPCSYLALGGWLTGITFVTSWYT HGLASSFLEGCNALTAAVSTPPNSMGHSLLLLLGSEAQWDFTRWLQIGGLWPFIALHGAF GLIGFMLRQFEIAKAVQIRPYNAIAFSAPISVFVSVFLIYPLGQSGWFFAPSFGVAAIFR FILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTIFEDGDSPNTFRAFNPLQS EETYSMVTANRFWSQIFGVAFSNKRWLHFFMVFVPVTGLRMSALGIVGLALNLRAYDFVS QEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHEQFIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cluster Of Differentiation 14 (CD14) Antibody (APC / Cyanine 7)
abx140923 100 Tests

Cluster Of Differentiation 14 (CD14) Antibody (APC / Cyanine 7)

Sign In for Pricing
View Details
NRF1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1342R-BF594-01 20 µL

NRF1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
NRF1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1342R-BF594-02 100 µL

NRF1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
PON1 Rabbit Polyclonal Antibody (Fluoro550)
orb3118029 100 µg

PON1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
H2 (H2-M3) (NM_013819) Mouse Tagged ORF Clone Lentiviral Particle
MR205000L4V 200 µL

H2 (H2-M3) (NM_013819) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rac trans-10,11-Dihydro-10,11-dihydroxy carbamazepine
FD27580-01 1 mg

Rac trans-10,11-Dihydro-10,11-dihydroxy carbamazepine

Sign In for Pricing
View Details