Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Photosystem II D2 protein (psbD)

This Recombinant Zea mays Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P48184

Expression Region

1-353

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRVTKEENDLFPLIDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWSQLGGLWTFLALHGA FALIGFMLRQFELARPVQLRPYNAISFSGPIAVFLSVFLIYPLGQSGWFFSPSFGVAAIF RFILFFQGFHNWTLKPFHMMGVAGVLGAVLLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromoionophore XVII
HY-167259 1 Each

Chromoionophore XVII

Sign In for Pricing
View Details
KRCC1 sgRNA CRISPR Lentivector set (Human)
K1164501 3x 1.0 µg

KRCC1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
(2,9-Di (anthracen-9-yl) -1,10-phenanthroline) iron chloride
IN12361 1 Each

(2,9-Di (anthracen-9-yl) -1,10-phenanthroline) iron chloride

Sign In for Pricing
View Details
C9orf116 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0270808 1.0 µg DNA

C9orf116 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Caspase 8 (CASP8) Protein
abx065775-01 10 µg

Human Caspase 8 (CASP8) Protein

Sign In for Pricing
View Details
Human Caspase 8 (CASP8) Protein
abx065775-02 50 µg

Human Caspase 8 (CASP8) Protein

Sign In for Pricing
View Details