Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Photosystem II D2 protein (psbD)

This Recombinant Marchantia polymorpha Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P06404

Expression Region

1-353

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGKSSKEPKGLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ARID3B Antibody [Alexa Fluor 488]
NBP2-98690AF488 0.1 mL

Rabbit Polyclonal ARID3B Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
AMY1C AAV siRNA Pooled Vector
11859161 1.0 µg

AMY1C AAV siRNA Pooled Vector

Sign In for Pricing
View Details
RPS10P6 ORF Vector (Human) (pORF)
42040011 1.0 µg DNA

RPS10P6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
P2rx2 Rabbit Polyclonal Antibody (HRP)
orb2133474 100 µL

P2rx2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Flt3 sgRNA CRISPR Lentivector set (Rat)
K7082201 3x 1.0 µg

Flt3 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Lmcd1 Mouse Pre-designed siRNA Set A
HY-RS19705 1 Set

Lmcd1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details