Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gossypium barbadense Photosystem II D2 protein (psbD)

This Recombinant Gossypium barbadense Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A0ZZ30

Expression Region

1-353

Origin

Gossypium barbadense (Sea-island cotton) (Egyptian cotton)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Tumor Protein, Translationally Controlled 1 ELISA Kit
MBS075876 Inquire

Pigeon Tumor Protein, Translationally Controlled 1 ELISA Kit

Sign In for Pricing
View Details
PSMB5, CT (PSMB5, LMPX, MB1, X, Proteasome subunit beta type-5, Macropain epsilon chain, Multicatalytic endopeptidase complex epsilon chain, Proteasome chain 6, Proteasome epsilon chain, Proteasome subunit MB1, Proteasome subunit X) (MaxLight 750) discontinued
040558-ML750 100 µL

PSMB5, CT (PSMB5, LMPX, MB1, X, Proteasome subunit beta type-5, Macropain epsilon chain, Multicatalytic endopeptidase complex epsilon chain, Proteasome chain 6, Proteasome epsilon chain, Proteasome subunit MB1, Proteasome subunit X) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Calcb 3'UTR Luciferase Stable Cell Line
TU201580 1.0 mL

Calcb 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Ethyl 2- (2,3-difluoro-6- (methoxymethoxy) phenyl) -2-oxoacetate
PC1018805-01 250 mg

Ethyl 2- (2,3-difluoro-6- (methoxymethoxy) phenyl) -2-oxoacetate

Sign In for Pricing
View Details
Ethyl 2- (2,3-difluoro-6- (methoxymethoxy) phenyl) -2-oxoacetate
PC1018805-02 500 mg

Ethyl 2- (2,3-difluoro-6- (methoxymethoxy) phenyl) -2-oxoacetate

Sign In for Pricing
View Details
Ethyl 2- (2,3-difluoro-6- (methoxymethoxy) phenyl) -2-oxoacetate
PC1018805-03 1 g

Ethyl 2- (2,3-difluoro-6- (methoxymethoxy) phenyl) -2-oxoacetate

Sign In for Pricing
View Details