Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gossypium barbadense Photosystem II D2 protein (psbD)

This Recombinant Gossypium barbadense Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A0ZZ30

Expression Region

1-353

Origin

Gossypium barbadense (Sea-island cotton) (Egyptian cotton)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Affinity Purified Rabbit anti-AU1
MBS560440-01 1 mg

Affinity Purified Rabbit anti-AU1

Sign In for Pricing
View Details
Affinity Purified Rabbit anti-AU1
MBS560440-02 5x 1 mg

Affinity Purified Rabbit anti-AU1

Sign In for Pricing
View Details
HHR23A/RAD23A Rabbit Polyclonal Antibody (PE)
orb2596594 100 µg

HHR23A/RAD23A Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human TNFRSF9 Protein, Fc Tag
E40KMPH5796 20 µg

Human TNFRSF9 Protein, Fc Tag

Sign In for Pricing
View Details
p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein
TP313083M 100 µg

p18 INK4c (CDKN2C) (NM_001262) Human Recombinant Protein

Sign In for Pricing
View Details
C5a anaphylatoxin chemotactic Receptor (C5AR1) Rat ELISA Kit
C0094 96 Tests

C5a anaphylatoxin chemotactic Receptor (C5AR1) Rat ELISA Kit

Sign In for Pricing
View Details