Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa Photosystem II D2 protein (psbD)

This Recombinant Populus trichocarpa Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4GYQ4

Expression Region

1-353

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMY2A3 Recombinant Protein
OPCD01284-10UG 10 µg

AMY2A3 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Inpp5d shRNA (UAS) - Lentiviral mouseInpp5d shRNA (UAS, GFP) (25)
GTR15127088 1 Vial

Lentiviral mouse Inpp5d shRNA (UAS) - Lentiviral mouseInpp5d shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Lentiviral human A1BG shRNA (UAS) - Lentiviral human A1BG shRNA (UAS, GFP) (25)
GTR15084716 1 Vial

Lentiviral human A1BG shRNA (UAS) - Lentiviral human A1BG shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
VEGF-D (Human) LumiAb ELISA Kit
MBS9511014-01 96 Strip Well

VEGF-D (Human) LumiAb ELISA Kit

Sign In for Pricing
View Details
VEGF-D (Human) LumiAb ELISA Kit
MBS9511014-02 5x 96 Strip Well

VEGF-D (Human) LumiAb ELISA Kit

Sign In for Pricing
View Details
VEGF-D (Human) LumiAb ELISA Kit
MBS9511014-03 10x 96 Strip Well

VEGF-D (Human) LumiAb ELISA Kit

Sign In for Pricing
View Details