Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabis hirsuta Photosystem II D2 protein (psbD)

This Recombinant Arabis hirsuta Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4QK13

Expression Region

1-353

Origin

Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGA FALIGFMLRQFELSRSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF640R conjugate, 0.1mg/mL
BNC400159-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(1S)-trans-Y-Cyhalothrin
TRC-C989855-2.5MG 2.5 mg

(1S)-trans-Y-Cyhalothrin

Sign In for Pricing
View Details
(KO Validated) SCD Polyclonal Antibody
E-AB-66816-01 60 µL

(KO Validated) SCD Polyclonal Antibody

Sign In for Pricing
View Details
(KO Validated) SCD Polyclonal Antibody
E-AB-66816-02 120 µL

(KO Validated) SCD Polyclonal Antibody

Sign In for Pricing
View Details
(KO Validated) SCD Polyclonal Antibody
E-AB-66816-03 200 µL

(KO Validated) SCD Polyclonal Antibody

Sign In for Pricing
View Details
GF-1 Bacterial DNA Extraction Kit (Proteinase K included), 50 preps
GF-BA-050 50 Preparations

GF-1 Bacterial DNA Extraction Kit (Proteinase K included), 50 preps

Sign In for Pricing
View Details