Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabis hirsuta Photosystem II D2 protein (psbD)

This Recombinant Arabis hirsuta Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4QK13

Expression Region

1-353

Origin

Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGA FALIGFMLRQFELSRSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARVCF (NM_001670) Human Over-expression Lysate
LC419792 20 µg

ARVCF (NM_001670) Human Over-expression Lysate

Sign In for Pricing
View Details
Rac-Taletrectinib-d4 Adipate
TRC-R939931-100MG 100 mg

Rac-Taletrectinib-d4 Adipate

Sign In for Pricing
View Details
MelanA (mLANA) (NM_005511) Human Recombinant Protein
TP304190L 1 mg

MelanA (mLANA) (NM_005511) Human Recombinant Protein

Sign In for Pricing
View Details
3-Oxohexanedioic Acid Diethyl Ester
TRC-O856830-1G 1 g

3-Oxohexanedioic Acid Diethyl Ester

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Sheep IgG,  20nm
GAF-551-20 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Sheep IgG, 20nm

Sign In for Pricing
View Details
Turbo Prime Broth™
0120 500 mL

Turbo Prime Broth™

Sign In for Pricing
View Details