Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lobularia maritima Photosystem II D2 protein (psbD)

This Recombinant Lobularia maritima Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4QLI9

Expression Region

1-353

Origin

Lobularia maritima (Sweet alyssum) (Alyssum maritimum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGA LALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acyclovir L-Isoleucinate
TRC-A192420-25MG 25 mg

Acyclovir L-Isoleucinate

Sign In for Pricing
View Details
Phospho-Tau (S202) Recombinant Rabbit Monoclonal Antibody [JE66-81]
HA721666 100 µL

Phospho-Tau (S202) Recombinant Rabbit Monoclonal Antibody [JE66-81]

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF488A conjugate, 0.1mg/mL
BNC880693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®568 Arachis hypogaea Lectin PNA (Peanut)
#29061 1x 1 mg

CF®568 Arachis hypogaea Lectin PNA (Peanut)

Sign In for Pricing
View Details
HSD3B1 Human Gene Knockout Kit (CRISPR)
KN204497 1 Kit

HSD3B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45RB (PD7/26), CF640R conjugate, 0.1mg/mL
BNC400472-500 1x 500 µL

CD45RB (PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details