Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Barbarea verna Photosystem II D2 protein (psbD)

This Recombinant Barbarea verna Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4QKA0

Expression Region

1-353

Origin

Barbarea verna (Land cress) (Early yellowrocket)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPKAQGDFTRWCQLGGLWAFVALHGA FALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cst3 Mouse shRNA Plasmid (Locus ID 13010)
TR500450 1 Kit

Cst3 Mouse shRNA Plasmid (Locus ID 13010)

Sign In for Pricing
View Details
Tspan18 3'UTR GFP Stable Cell Line
TU272557 1.0 mL

Tspan18 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HSD17B3 Antibody / 17-beta-HSD 3
R35914-100UG 100 µg

HSD17B3 Antibody / 17-beta-HSD 3

Sign In for Pricing
View Details
TESK2 Lentiviral Activation Particles (m)
sc-432964-LAC 200 µL

TESK2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Cdc23 Recombinant Antibody, Cy7 Conjugated
bsm-60687R-Cy7-TR 20 µL

Cdc23 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Eco AluRack (HxD) 3x5=15 boxes, 50mm, 168x683x139mm
TE11250 1 Piece

Eco AluRack (HxD) 3x5=15 boxes, 50mm, 168x683x139mm

Sign In for Pricing
View Details