Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsella bursa-pastoris Photosystem II D2 protein (psbD)

This Recombinant Capsella bursa-pastoris Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4QKI7

Expression Region

1-353

Origin

Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGA FALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppid sgRNA CRISPR Lentivector (Rat) (Target 3)
K7137904 1.0 µg DNA

Ppid sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rat Teratocarcinoma-Derived Growth Factor 1 (TDGF1) Protein
abx691324 50 µg

Rat Teratocarcinoma-Derived Growth Factor 1 (TDGF1) Protein

Sign In for Pricing
View Details
Rabbit Polyclonal VWDE Antibody
NBP2-32714-25ul 25 µL

Rabbit Polyclonal VWDE Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Osteopontin/OPN Antibody (rOSP/8856) [Alexa Fluor 700]
NBP3-24112AF700 0.1 mL

Mouse Monoclonal Osteopontin/OPN Antibody (rOSP/8856) [Alexa Fluor 700]

Sign In for Pricing
View Details
INPP5A Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-16670R-BF647 100 µL

INPP5A Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
CCDC45 Protein Vector (Human) (pPB-N-His)
PV007946 500 ng

CCDC45 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details