Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsella bursa-pastoris Photosystem II D2 protein (psbD)

This Recombinant Capsella bursa-pastoris Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4QKI7

Expression Region

1-353

Origin

Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGA FALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-) -Dihydrocarvyl acetate
TN6698 20 mg

(-) -Dihydrocarvyl acetate

Sign In for Pricing
View Details
MFluor™ UV375 Anti-human CD71 Antibody *HI160*
107100X0-AAT 100 Tests

MFluor™ UV375 Anti-human CD71 Antibody *HI160*

Sign In for Pricing
View Details
pDNR-LIB-INSL4 Plasmid
PVT27866 2 µg

pDNR-LIB-INSL4 Plasmid

Sign In for Pricing
View Details
HABP4 Rabbit Polyclonal Antibody (FITC)
orb2090484 100 µL

HABP4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Human Cementoblastoma-derived protein 1 (CEMP1)
orb1650908-01 20 µg

Recombinant Human Cementoblastoma-derived protein 1 (CEMP1)

Sign In for Pricing
View Details
Recombinant Human Cementoblastoma-derived protein 1 (CEMP1)
orb1650908-02 100 µg

Recombinant Human Cementoblastoma-derived protein 1 (CEMP1)

Sign In for Pricing
View Details