Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsella bursa-pastoris Photosystem II D2 protein (psbD)

This Recombinant Capsella bursa-pastoris Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4QKI7

Expression Region

1-353

Origin

Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGA FALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG2a Isotype Control (PE)
abx200574 50 µg

Mouse IgG2a Isotype Control (PE)

Sign In for Pricing
View Details
ZBTB12 Polyclonal Antibody, APC Conjugated
bs-13565R-APC 100 µL

ZBTB12 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus 60 kDa chaperonin 1 (groL1), partial
MBS1420798 Inquire

Recombinant Prochlorococcus marinus 60 kDa chaperonin 1 (groL1), partial

Sign In for Pricing
View Details
CysC) Human ELISA Kit
99319 96 Tests

CysC) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CUTC Protein
NBP1-72425-0.5mg 0.5 mg

Recombinant Human CUTC Protein

Sign In for Pricing
View Details
Rnase2a Mouse Gene Knockout Kit (CRISPR)
KN514869 1 Kit

Rnase2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details