Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crucihimalaya wallichii Photosystem II D2 protein (psbD)

This Recombinant Crucihimalaya wallichii Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4QKS6

Expression Region

1-353

Origin

Crucihimalaya wallichii (Rock-cress) (Arabidopsis campestris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-500 1x 500 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-100 1x 100 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details