Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lepidium virginicum Photosystem II D2 protein (psbD)

This Recombinant Lepidium virginicum Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A4QLA1

Expression Region

1-353

Origin

Lepidium virginicum (Virginia pepperweed)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL2 Receptor beta Polyclonal Antibody, Cy5 Conjugated
bs-1959R-Cy5 100 µL

IL2 Receptor beta Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
METTL21C siRNA (Human)
orb1852075-01 15 nmol

METTL21C siRNA (Human)

Sign In for Pricing
View Details
METTL21C siRNA (Human)
orb1852075-02 30 nmol

METTL21C siRNA (Human)

Sign In for Pricing
View Details
Human RPUSD1 knockout cell line
ABC-KH13196 1 Vial

Human RPUSD1 knockout cell line

Sign In for Pricing
View Details
Apex2 (NM_001079892) Rat Tagged Lenti ORF Clone
RR202845L4 10 µg

Apex2 (NM_001079892) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Piccolo Polyclonal Antibody, HRP Conjugated
bs-11354R-HRP 100 µL

Piccolo Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details