Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta gronovii Photosystem II D2 protein (psbD)

This Recombinant Cuscuta gronovii Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A7M8Z6

Expression Region

1-353

Origin

Cuscuta gronovii (Common dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTITLGQSTKNDKDLFDTMDDWLRRDRFLFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCKLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFFIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVSGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRASEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRAP Human Gene Knockout Kit (CRISPR)
KN417076 1 Kit

NRAP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HPRT1 Antibody
KC-14178-01 50 μL

HPRT1 Antibody

Sign In for Pricing
View Details
HPRT1 Antibody
KC-14178-02 100 µL

HPRT1 Antibody

Sign In for Pricing
View Details
HPRT1 Antibody
KC-14178-03 1 mL

HPRT1 Antibody

Sign In for Pricing
View Details
Vitamin D Receptor Recombinant Rabbit Monoclonal Antibody [JA11-16]
ET1704-09 100 µL

Vitamin D Receptor Recombinant Rabbit Monoclonal Antibody [JA11-16]

Sign In for Pricing
View Details
JAK2 Mouse Monoclonal Antibody [Clone ID: OTI2F5]
CF806792 100 µg

JAK2 Mouse Monoclonal Antibody [Clone ID: OTI2F5]

Sign In for Pricing
View Details