Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vitis vinifera Photosystem II D2 protein (psbD)

This Recombinant Vitis vinifera Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q0ZJ25

Expression Region

1-353

Origin

Vitis vinifera (Grape)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDESDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clcn7 (NM_011930) Mouse Tagged Lenti ORF Clone
MR210742L3 10 µg

Clcn7 (NM_011930) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPS12P29 sgRNA CRISPR Lentivector (Human) (Target 1)
K2027202 1.0 µg DNA

RPS12P29 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ACTH (POMC) Mouse Monoclonal Antibody [Clone:2B2]
E45M13895 100 µg

ACTH (POMC) Mouse Monoclonal Antibody [Clone:2B2]

Sign In for Pricing
View Details
TREH siRNA (Human)
CRH7661-01 15 nmol

TREH siRNA (Human)

Sign In for Pricing
View Details
TREH siRNA (Human)
CRH7661-02 30 nmol

TREH siRNA (Human)

Sign In for Pricing
View Details
FRS2 Rabbit Monoclonal Antibody
E28G1732 100 µL

FRS2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details