Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Photosystem II D2 protein (psbD)

This Recombinant Glycine max Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q2PMT8

Expression Region

1-353

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAB3GAP1 activation kit by CRISPRa
GA107921 1 Kit

Human RAB3GAP1 activation kit by CRISPRa

Sign In for Pricing
View Details
ADAMTS2 Polyclonal Antibody
E-AB-53415-01 20 µL

ADAMTS2 Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTS2 Polyclonal Antibody
E-AB-53415-02 60 µL

ADAMTS2 Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTS2 Polyclonal Antibody
E-AB-53415-03 120 µL

ADAMTS2 Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTS2 Polyclonal Antibody
E-AB-53415-04 200 µL

ADAMTS2 Polyclonal Antibody

Sign In for Pricing
View Details
Human NIR1 (PITPNM3) activation kit by CRISPRa
GA113160 1 Kit

Human NIR1 (PITPNM3) activation kit by CRISPRa

Sign In for Pricing
View Details