Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staurastrum punctulatum Photosystem II D2 protein (psbD)

This Recombinant Staurastrum punctulatum Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q32RT0

Expression Region

1-353

Origin

Staurastrum punctulatum (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGKSSKQPQGLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVAFHGA FGLIGFMLRQFEIARSVGLRPYNAIAFTGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTIFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFANKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O3-Desethyl Apremilast
TRC-D291185-50MG 50 mg

O3-Desethyl Apremilast

Sign In for Pricing
View Details
UBN1 Human Gene Knockout Kit (CRISPR)
KN415072 1 Kit

UBN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GSTA4 Antibody
KC-3811-01 50 μL

GSTA4 Antibody

Sign In for Pricing
View Details
GSTA4 Antibody
KC-3811-02 100 µL

GSTA4 Antibody

Sign In for Pricing
View Details
GSTA4 Antibody
KC-3811-03 1 mL

GSTA4 Antibody

Sign In for Pricing
View Details
HLVd TaqMan Probe/Primer and Control Set
TM38710 100 Reactions

HLVd TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details