Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staurastrum punctulatum Photosystem II D2 protein (psbD)

This Recombinant Staurastrum punctulatum Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q32RT0

Expression Region

1-353

Origin

Staurastrum punctulatum (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGKSSKQPQGLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVAFHGA FGLIGFMLRQFEIARSVGLRPYNAIAFTGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTIFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFANKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adiponectin (Marker of Obesity) (ADPN/1370), CF568 conjugate, 0.1mg/mL
BNC681370-100 1x 100 µL

Adiponectin (Marker of Obesity) (ADPN/1370), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Stability Test Chamber BTST-1605
BTST-1605 1 Unit

Stability Test Chamber BTST-1605

Sign In for Pricing
View Details
AMHR2 (N-term) Rabbit Polyclonal Antibody
AP13726PU-N 400 µL

AMHR2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DRD1 Recombinant Rabbit Monoclonal Antibody [JM10-93]
ET1703-45 100 µL

DRD1 Recombinant Rabbit Monoclonal Antibody [JM10-93]

Sign In for Pricing
View Details
ST3GAL5 (NM_003896) Human Over-expression Lysate
LC401284 20 µg

ST3GAL5 (NM_003896) Human Over-expression Lysate

Sign In for Pricing
View Details
C14orf50 (PPP1R36) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C10]
TA809454AM 100 µL

C14orf50 (PPP1R36) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C10]

Sign In for Pricing
View Details