Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staurastrum punctulatum Photosystem II D2 protein (psbD)

This Recombinant Staurastrum punctulatum Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q32RT0

Expression Region

1-353

Origin

Staurastrum punctulatum (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGKSSKQPQGLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVAFHGA FGLIGFMLRQFEIARSVGLRPYNAIAFTGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTIFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFANKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYR61 / CCN1 Recombinant Rabbit Monoclonal Antibody [PSH09-12]
HA723070 100 µL

CYR61 / CCN1 Recombinant Rabbit Monoclonal Antibody [PSH09-12]

Sign In for Pricing
View Details
Polystyrene A FP
HA12516007.100G 100 g

Polystyrene A FP

Sign In for Pricing
View Details
Xenon Difluoride
TRC-X744458-250MG 250 mg

Xenon Difluoride

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), CF740 conjugate, 0.1mg/mL
BNC743102-500 1x 500 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCN2 (NM_000355) Human Over-expression Lysate
LC424773 20 µg

TCN2 (NM_000355) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC34A2 (NM_006424) Human Over-expression Lysate
LC401933 20 µg

SLC34A2 (NM_006424) Human Over-expression Lysate

Sign In for Pricing
View Details