Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus globulus subsp. globulus Photosystem II D2 protein (psbD)

This Recombinant Eucalyptus globulus subsp. globulus Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q49L03

Expression Region

1-353

Origin

Eucalyptus globulus subsp. globulus (Tasmanian blue gum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast, right
CS712691 5x 5 µm

Tissue FFPE Sections, Breast, right

Sign In for Pricing
View Details
RGS9 (NM_001165933) Human Over-expression Lysate
LC431426 20 µg

RGS9 (NM_001165933) Human Over-expression Lysate

Sign In for Pricing
View Details
HSPA4L (C-term) Rabbit Polyclonal Antibody
AP18058PU-N 400 µL

HSPA4L (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2',7'-Dichlorodihydrofluorescein Diacetate
TRC-D434215-250MG 250 mg

2',7'-Dichlorodihydrofluorescein Diacetate

Sign In for Pricing
View Details
ST8SIA6 Human Gene Knockout Kit (CRISPR)
KN415585 1 Kit

ST8SIA6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant APC Monoclonal Antibody
E-AB-81529-01 50 µL

Recombinant APC Monoclonal Antibody

Sign In for Pricing
View Details