Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nuphar advena Photosystem II D2 protein (psbD)

This Recombinant Nuphar advena Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q4FFP2

Expression Region

1-353

Origin

Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGRFTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog AQP2 / Aquaporin-2 Recombinant Protein
R0580d 1 Each

Dog AQP2 / Aquaporin-2 Recombinant Protein

Sign In for Pricing
View Details
SIGLEC8 Antibody
37922 100 µL

SIGLEC8 Antibody

Sign In for Pricing
View Details
Ephrin-B3 (D-11) Alexa Fluor® 594
sc-390696 AF594 200 µg/mL

Ephrin-B3 (D-11) Alexa Fluor® 594

Sign In for Pricing
View Details
Rabbit Monoclonal KLRG1 Antibody (1151A) [PE/Cy7]
FAB6944PECY7 0.1 mL

Rabbit Monoclonal KLRG1 Antibody (1151A) [PE/Cy7]

Sign In for Pricing
View Details
GRIP2 (NM_001080423) Human Over-expression Lysate
LS080852-100ug 100 µg

GRIP2 (NM_001080423) Human Over-expression Lysate

Sign In for Pricing
View Details
FASTKD5 Antibody
orb252824 100 µL

FASTKD5 Antibody

Sign In for Pricing
View Details