Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nuphar advena Photosystem II D2 protein (psbD)

This Recombinant Nuphar advena Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q4FFP2

Expression Region

1-353

Origin

Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGRFTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-NuMA (Ser395) Blocking Peptide
MBS9615257-01 1 mg

Phospho-NuMA (Ser395) Blocking Peptide

Sign In for Pricing
View Details
Phospho-NuMA (Ser395) Blocking Peptide
MBS9615257-02 5x 1 mg

Phospho-NuMA (Ser395) Blocking Peptide

Sign In for Pricing
View Details
Bovine Globotriasylceramide ELISA ki
GTR10386425 96 Well

Bovine Globotriasylceramide ELISA ki

Sign In for Pricing
View Details
Sdhb ORF Vector (Rat) (pORF)
43254016 1.0 µg DNA

Sdhb ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CREM sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2820606 1.0 µg DNA

CREM sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
FOXN3 Polyclonal Conjugated Antibody
orb1627724 100 µL

FOXN3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details