Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta sandwichiana Photosystem II D2 protein (psbD)

This Recombinant Cuscuta sandwichiana Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q49CA8

Expression Region

1-353

Origin

Cuscuta sandwichiana (Kauna'oa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTITLGQSTKNDKDLFDTMDDWLRRDRFLFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCKLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFFIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVSGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRASEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF640R conjugate, 0.1mg/mL
BNC401571-500 1x 500 µL

GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SEPTIN4 (33-44) Goat Polyclonal Antibody
AP22420PU-N 100 µg

SEPTIN4 (33-44) Goat Polyclonal Antibody

Sign In for Pricing
View Details
GPNMB Polyclonal Antibody
E-AB-40473-01 25 µL

GPNMB Polyclonal Antibody

Sign In for Pricing
View Details
GPNMB Polyclonal Antibody
E-AB-40473-02 100 µL

GPNMB Polyclonal Antibody

Sign In for Pricing
View Details
IL17D (C-term) Rabbit Polyclonal Antibody
AP52187PU-N 400 µL

IL17D (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Culture Tubes
T8236 1000 Units/Case

Culture Tubes

Sign In for Pricing
View Details