Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta sandwichiana Photosystem II D2 protein (psbD)

This Recombinant Cuscuta sandwichiana Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q49CA8

Expression Region

1-353

Origin

Cuscuta sandwichiana (Kauna'oa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTITLGQSTKNDKDLFDTMDDWLRRDRFLFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCKLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFFIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVSGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRASEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Seminal vesicle
CS803185 5x 5 µm

Tissue FFPE Sections, Seminal vesicle

Sign In for Pricing
View Details
Banp Mouse Gene Knockout Kit (CRISPR)
KN501975 1 Kit

Banp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD46 (122.2), 1mg/mL
BNUM0175-50 1x 50 µL

CD46 (122.2), 1mg/mL

Sign In for Pricing
View Details
Polystyrene A NH₂
HA40045002.5G 5 g

Polystyrene A NH₂

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), Biotin conjugate, 0.1mg/mL
BNCB2448-500 1x 500 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Slamf8 Mouse Gene Knockout Kit (CRISPR)
KN515849 1 Kit

Slamf8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details