Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta sandwichiana Photosystem II D2 protein (psbD)

This Recombinant Cuscuta sandwichiana Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q49CA8

Expression Region

1-353

Origin

Cuscuta sandwichiana (Kauna'oa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTITLGQSTKNDKDLFDTMDDWLRRDRFLFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCKLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFFIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVSGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRASEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDR2 (NM_001014796) Human Over-expression Lysate
LY425366 100 µg

DDR2 (NM_001014796) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS507438 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013S-01 50 Tests

Elab Fluor® Red 780 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013S-02 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013S-03 2x 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Cytokeratin 18 (DA7), CF488A conjugate, 0.1mg/mL
BNC880198-500 1x 500 µL

Cytokeratin 18 (DA7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details