Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactuca sativa Photosystem II D2 protein (psbD)

This Recombinant Lactuca sativa Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q56P05

Expression Region

1-353

Origin

Lactuca sativa (Garden lettuce)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKVTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFAVGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATHL1 HDR Plasmid (m)
sc-431829-HDR 20 µg

ATHL1 HDR Plasmid (m)

Sign In for Pricing
View Details
PRAMEF10 3'UTR Lenti-reporter-Luc Vector
37527081 1.0 µg

PRAMEF10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TMEM150A ORF Vector (Human) (pORF)
ORF034001 1.0 µg DNA

TMEM150A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Resorufin sodium salt 500mg
A21344-500 500 mg

Resorufin sodium salt 500mg

Sign In for Pricing
View Details
IRF5 Polyclonal Antibody
MBS128124-01 0.02 mL

IRF5 Polyclonal Antibody

Sign In for Pricing
View Details
IRF5 Polyclonal Antibody
MBS128124-02 0.1 mL

IRF5 Polyclonal Antibody

Sign In for Pricing
View Details